PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G27045.1
Common NameATHB54, ATHB-54, HB54, T7N9.11
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family HD-ZIP
Protein Properties Length: 227aa    MW: 26623.8 Da    PI: 4.9649
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G27045.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.59.6e-1868121356
                  --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  k++++t+ ql+ Lee Fe+++ +  +++  LA+klgL+ +qV vWFqNrRa++k
  AT1G27045.1  68 KKRKLTPIQLRLLEESFEEEKRLEPDRKLWLAEKLGLQPSQVAVWFQNRRARYK 121
                  56699************************************************9 PP

2HD-ZIP_I/II116.21.9e-3768158292
  HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                  kkr+l+  q++lLEesFeee++Lep+rK  la++Lglqp qvavWFqnrRAR+ktkqlE+d+++Lk++y +lk++ + L  ++++L+++++
  AT1G27045.1  68 KKRKLTPIQLRLLEESFEEEKRLEPDRKLWLAEKLGLQPSQVAVWFQNRRARYKTKQLEHDCDSLKASYAKLKTDWDILFVQNQTLKSKVD 158
                  9**************************************************************************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.3E-1851125IPR009057Homeodomain-like
PROSITE profilePS5007116.42263123IPR001356Homeobox domain
SMARTSM003894.3E-1766127IPR001356Homeobox domain
PfamPF000464.4E-1568121IPR001356Homeobox domain
CDDcd000864.74E-1568124No hitNo description
Gene3DG3DSA:1.10.10.601.3E-1870129IPR009057Homeodomain-like
PRINTSPR000317.2E-594103IPR000047Helix-turn-helix motif
PROSITE patternPS00027098121IPR017970Homeobox, conserved site
PRINTSPR000317.2E-5103119IPR000047Helix-turn-helix motif
PfamPF021836.7E-15123164IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
MENSDTDSEV FFWFQNQNQN HSHKFPSSCF PPSSHSAFYG SSSMINTETA TMDEEDVCES  60
YMMREITKKR KLTPIQLRLL EESFEEEKRL EPDRKLWLAE KLGLQPSQVA VWFQNRRARY  120
KTKQLEHDCD SLKASYAKLK TDWDILFVQN QTLKSKVDLL KEKLKMQENL ETQSIERKRL  180
GEEGSSVKSD NTQYSEEEGL ENQYSFPELA VLGFYYDPTL TASNLRL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1115123RRARYKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.753570.0flower
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAT1G27045
AtGenExpressAT1G27045
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Predominantly expressed in flowers and siliques. {ECO:0000269|PubMed:16055682}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G27045.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G27045
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0003480.0AC000348.2 Genomic sequence for Arabidopsis thaliana BAC T7N9 from chromosome I, complete sequence.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001185103.11e-169homeobox-leucine zipper protein ATHB-54
SwissprotP0CJ651e-171ATB54_ARATH; Homeobox-leucine zipper protein ATHB-54
TrEMBLV4K9K41e-136V4K9K4_EUTSA; Uncharacterized protein
STRINGAT1G27045.11e-169(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM159081314
Representative plantOGRP12916189
Publications ? help Back to Top
  1. Henriksson E, et al.
    Homeodomain leucine zipper class I genes in Arabidopsis. Expression patterns and phylogenetic relationships.
    Plant Physiol., 2005. 139(1): p. 509-18
    [PMID:16055682]